Boulder dushanbe tea house menu. Food delivery is a big plus of this place.
Boulder dushanbe tea house menu. Oct 4, 2024 · The teahouse has also represented far more than its exquisite tea and food fare offerings to countless individuals—community members, activists, artisans and more—ever since it was conceptualized. Join us at the Teahouse for a unique Dim Sum & Oolong Afternoon Tea Service, with delicious tea infused, dim sum delicacies and premium tea selections, and enjoy a unique and adventurous experience. For a brief moment, I didn’t think I would be able to visit the Teahouse on this trip, as the airport in Denver was covered in thick fog, with only the minimum 1/4 mile visibility available for landing a commercial jetliner. Whether you’re a local or a The Story of the Teahouse THE HiSTORY In 1987, during his first visit to Boulder, Mayor Maksud Ikramov announced that Dushanbe planned to present our city with a Teahouse to celebrate the establishment of sister city ties. Boulder Dushanbe Tea House – a restaurant in the 2024 MICHELIN Guide USA. m. From the moment I arrived I was in awe of how beautiful this place is. This fee goes directly to our hardworking and creative kitchen staff. Visitors can enjoy local experiences like brunch, afternoon tea ceremonies, cultural performances, tranquil gardens, and exotic cuisine. At Boulder Dushanbe Teahouse, we are proud to offer an exquisite afternoon tea service, served daily from 3 p. to 9:00 p. No delivery fee on your first order! The Boulder Dushanbe Teahouse in Boulder, browse the original menu, discover prices, read customer reviews. 5 Vegetarian pita, hummus, roasted eggplant, egg, tomato, cucumber, red onion, pickled jalapeño, cilantro, parsley, dressed with amba, zhoug & tahini, served with pearl couscous salad Uruguay Chivito WHOLESALE & PRIVATE LABEL OPPORTUNITIES VISIT OUR FAMILY OF THREE LEAF CONCEPTS Leaf Vegetarian Restaurant | The Chautauqua Dining Hall | Zucca Italian Ristorante | The Huckleberry Three Leaf Farm | The Boulder Tea Company Learn more SMALL PLATES Volcan de Guanajuato 10. 5 Sweet Seduction White Tea - irresistible light white tea with a soft raspberry flavor and lemony finish 4. Buy Rare, Premium, Loose Leaf Tea from The Boulder Dushanbe Teahouse Online Store, as well as Yixing, Testubin, & other Teapots & Unique Tea Accessories Indian Dosa at Boulder Dushanbe Teahouse "The ambiance here is amazing. Each element of the building, from the hand-carved wooden columns to the vibrant ceramic panels, was meticulously crafted in Tajikistan before being transported to Boulder and assembled by a team of skilled artisans. A central point of information and communication between Boulder, Colorado and Dushanbe, Tajikistan. A truly stunning piece of architecture. If you are interested in making a reservation for our Afternoon Tea Service, including our monthly Dim Sum service, please send an e-mail to info Dec 20, 2016 · Specialties: The Boulder Dushanbe Teahouse is nestled against the Rocky Mountain Foothills in Boulder Colorado. Established in 1990 Hummus at Boulder Dushanbe Teahouse "Ordered:Rainforest Iced Tea (~$4): lemonade, pineapple juice, ginseng mango mate energizer. The tea is awesome with a huge selection, even for a non-tea drinker like me, I loved the Chai and the to go cup… The Boulder Dushanbe Teahouse is nestled against the Rocky Mountain Foothills in Boulder Colorado. Spicy Chocolate White Tea - smooth white chocolate with a kick of spicy chili finish, this tea is both delicious and unexpected 4. People dine for lunch or tea at the Boulder Dushanbe Teahouse this month in Boulder. These 10 beloved spots are too good to stay secret. As the name suggests, tea is the raison d'être here, and The tea house was a gift from Boulder’s sister city, Tajikistan. The teahouse was a gift to the city of Boulder by the mayor of Dushanbe, Tajikistan, after a visit in 1987 and Nov 7, 2023 · Specialties: The Boulder Dushanbe Teahouse is nestled against the Rocky Mountain Foothills in Boulder Colorado. RESERVATIONS OPEN 60 DAYs in ADVANCE of the tea time date. The Tajik plov was a really interesting, and incredibly tasty,… Dec 12, 2012 · In the program, Boulder and Dushanbe agreed to exchange one building each, and in exchange for the incredible tea house, Dushanbe received an internet cafe. Built in the late 1980s, it was a gift from Boulder’s sister city of Dushanbe, Tajikistan. Olga Feheley and 11 others 12 Boulder Teahouse Mar 30 Enjoy teas from around the world, a seasonal international menu, tea infused cocktails, and a wonderful atmosphere in one of America's most beautiful teahouses. Established in 1990 This hand-built gift from Dushanbe, Boulder's sister city in Tajikistan, offers a respite from quotidian life. While the menu was a little different, it still hits the sister city theme wonderfully. It was a pretty location, but really poor service and food was just ok. Established in 1990 In addition to the Afternoon Tea between 3pm and 5pm, we also serve a smaller mid-day menu for walk in guests without reservations. Completely built by hand without the use of any power tools, the Teahouse was Jan 16, 2025 · The best high tea in Boulder, CO are The Boulder Dushanbe Teahouse, Ku Cha House of Tea, and Alice and Rose. As the name suggests, tea is the raison d'être here, and 20 hours ago · Colorado’s food scene is full of hidden gems locals keep close to the chest. They serve international cuisine for breakfast, lunch, dinner and weekend brunch. Nov 7, 2023 · Specialties: The Boulder Dushanbe Teahouse is nestled against the Rocky Mountain Foothills in Boulder Colorado. Specialties: The Boulder Dushanbe Teahouse is nestled against the Rocky Mountain Foothills in Boulder Colorado. The MICHELIN inspectors’ point of view, information on prices, types of cuisine and opening hours on the MICHELIN Guide's official website This hand-built gift from Dushanbe, Boulder's sister city in Tajikistan, offers a respite from quotidian life. Get a sneak peek of your next meal. Dim Sum Tea Time Our Dim Sum Teatime is very popular and sells out quickly. Let’s dive into what makes high tea at this teahouse so special, from the ornate setting to the mouth-watering menu. The tea menu at the Teahouse consists of over 100 premium loose leaf teas. We would like to show you a description here but the site won’t allow us. Feb 23, 2024 · The Boulder Dushanbe Tea House has become a beloved landmark in the city of Boulder. Established in 1990 With an exotic menu, gorgeous ambiance, reasonable pricing, and simply delicious food, the Dushanbe Teahouse in Boulder, CO will forever be an amazing and memorable experience from my trip that I would wish to revisit in the future. The' The Boulder Dushanbe Teahouse is nestled against the Rocky Mountain Foothills in Boulder Colorado. HOURS of Operation MONDAY - FRIDAY Lunch: 11 am – 3 pm Teatime: 3 pm - 5 pm Dinner: 5 pm – 9 pm SATURDAY & SUNDAY Brunch: 8 am – 3 pm Teatime: 3 pm - 5 pm Dinner: 5 pm – 9 pm For take out hours, see menu Restaurant menu, map for Boulder Dushanbe Teahouse located in 80302, Boulder CO, 1770 13th St. The Teahouse offers more than 100 types of teas and a full bar. The addition of milk, almond, soy or oatmilk balances the boldness of the tea and spices perfectly, while a touch of natural sugar gives the chai its sweetness. The' Specialties: The Boulder Dushanbe Teahouse is nestled against the Rocky Mountain Foothills in Boulder Colorado. This hand-built gift from Dushanbe, Boulder's sister city in Tajikistan, offers a respite from quotidian life. The MICHELIN inspectors’ point of view, information on prices, types of cuisine and opening hours on the MICHELIN Guide's official website May 24, 2021 · Reviews of vegan-friendly restaurant Boulder Dushanbe Teahouse in Boulder, Colorado, USA 'The Dushanbe Teahouse has a truly beautiful atmosphere – the architecture and decor are stunning, and the staff is genuinely warm and welcoming. Boulder Dushanbe Teahouse Menu and Prices. Our experienced chefs and exceptional service staff will create a memorable occasion that will fit both Specialties: The Boulder Dushanbe Teahouse is nestled against the Rocky Mountain Foothills in Boulder Colorado. Order Online, get delivery, see prices and reviews. Established in 1990 Specialties: The Boulder Dushanbe Teahouse is nestled against the Rocky Mountain Foothills in Boulder Colorado. These services are seated on a first-come, first-served basis. Find your favorite food and enjoy your meal. com Specialties: The Boulder Dushanbe Teahouse is nestled against the Rocky Mountain Foothills in Boulder Colorado. Sunlight filters through stained-glass windows, casting This hand-built gift from Dushanbe, Boulder's sister city in Tajikistan, offers a respite from quotidian life. Sitting alongside Boulder Creek in Central Park, the Teahouse is considered one of Boulder’s most attractive and popular tourist attractions, as well as being a local favorite for great food, tea, and atmosphere. After construction, it was disassembled This hand-built gift from Dushanbe, Boulder's sister city in Tajikistan, offers a respite from quotidian life. 25 GF, Vegan eggplant stuffed with rice, split pea, onion, dried fruit, herbs, Persian “ Join us for Afternoon Tea and make memories for birthday parties, bridal showers, baby showers, holiday events, or any other event you want to remember! ” — Boulder Dushanbe Teahouse The Exterior of the Teahouse boasts hand crafted ceramic mosaic tiles and a roof border of exquisite beauty and craftsmanship. All of our teas are carefully selected for freshness, quality, and taste. They sent us the beautiful tea house, and then a local Boulder group raised money to get the tea house reassembled here. Feb 5, 2025 · The recipe for success of The Boulder Dushanbe Teahouse is its tasty vanilla ice cream, crepes and sticky toffee pudding. We sent them a cyber café, if I remember correctly. Established in 1990 MICHELIN Guide’s Point Of View This hand-built gift from Dushanbe, Boulder's sister city in Tajikistan, offers a respite from quotidian life. Out of an extensive tea menu I chose a seasonal special green tea with lychee leaves. 5 Puerh Teas Elephant Moon 2010 - cooked pressed pu-erh, complex, rich, bold, smooth aftertaste 4. 75 GFO Persian herb omelet, baba ghanoush, crispy rice lapsang souchong tea-rubbed pork, ham, gruyere cheese, house-made pickle, dijon aioli, pressed Cuban roll, fries Middle Eastern Sabich 15. Completely built by hand without the use of any power tools, the Teahouse was The Teahouse accepts online reservations for dinner from Monday through Sunday, 5:00 p. The Teahouse offers exceptional catering services and we are committed to providing fresh, delicious menus that will dazzle and delight your guests. As the name suggests, tea is the raison d'être here, and Oct 16, 2009 · The Boulder Dushanbe Teahouse offers a full menu, including vegetarian options, that changes seasonally. It was handcrafted in Dushanbe and shipped to Colorado in 200 crates. Restaurnat rating 4 based on 186 votes American Breakfast at Boulder Dushanbe Teahouse "Had a wonderful brunch here, with a short 20 minute wait on the weekends. Walk through the front garden and you'll be instantly transported to a zen-filled, magical space. Whether enjoyed on its own or with a pastry, teahouse chai is a delightful beverage that warms the heart and soul. The teahouse also offers tea workshops and special events throughout the year. You will hardly forget good wine, beer or champagne that you can try. Forty Tajik artisans hand-made the teahouse over a period of two years, took it apart, and then packed the pieces into about 200 crates to be shipped to Boulder. Private Events, Parties & Catering For over 25 years, the Boulder Dushanbe Teahouse has been Boulder’s most beautiful and unique event venue. to 5 p. The building, a handcrafted gift from Boulder's sister city Dushanbe in Tajikistan, showcases intricate wood carvings, hand-painted ceilings, and ornate ceramic tiles that captivate the eye. 5 At The Teahouse, there is a 4 % Kitchen & Farmer Living Wage Surcharge added to each Guest check to address the growing wage disparity among restaurant team members. After 25 years on 13th Street, North America’s only authentic Persian teahouse is a dining landmark that is always on tourists’ […] Specialties: The Boulder Dushanbe Teahouse is nestled against the Rocky Mountain Foothills in Boulder Colorado. We have a wide variety of teaware for every taste. Below, learn more from Chef Lenny Martinelli about his flagship restaurant, cross-cultural history, and his passion for sustainability. I love coming in for breakfast. The tea and the food was excellent. Established in 1990 May 4, 2023 · The Boulder Dushanbe Teahouse is an otherworldly icon. Boulder Dushanbe Tea House – a restaurant in the 2023 MICHELIN Guide USA. Established in 1990 Mar 31, 2024 · People dine for lunch or tea at the Boulder Dushanbe Teahouse this month in Boulder. The teahouse not only offers a unique dining experience but also provides a window into the rich history and traditions of This hand-built gift from Dushanbe, Boulder's sister city in Tajikistan, offers a respite from quotidian life. High Tea at The Boulder Dushanbe Teahouse High tea is a tradition that dates back to the early 19th century in England. 5 chicory coffee, sweetened condensed milk, served hot or iced tea At The Teahouse, there is a 4 % Kitchen & Farmer Living Wage Surcharge added to each Guest check to address the growing wage disparity among restaurant team members. Sitting alongside Boulder Creek in Central Park, the Teahouse is considered one of Boulder's most attractive and popular tourist attractions, as well as being a local favorite for great food, tea, and atmosphere. Established in 1990 The Dushanbe Teahouse is a centuries-old tradition brought over from Tajikistan and rebuilt as a creekside oasis in Boulder. Restaurnat rating 4 based on 186 votes Up to date Boulder Dushanbe Teahouse menu and prices, including breakfast, dinner, kid's meal and more. Menu for Boulder Dushanbe Teahouse: Reviews and photos of Tajikistan Osh - TO GO, Indian Dosa TO GO!!, Lapsang Souchong Benedict - TO GO!! View the menu for Boulder Dushanbe Tea House in Boulder, CO. The hand-painted mosaics, woodwork, and attention to historical detail create an Feb 17, 2025 · The Tajikistan capital city gifted a one-of-a-kind, handmade tea house to the Colorado mountain town, and for the last 26 years, Boulder Dushanbe Teahouse has impressed visitors and locals alike. Aug 7, 2025 · Reviews of vegan-friendly restaurant Boulder Dushanbe Teahouse in Boulder, Colorado, USA 'The Dushanbe Teahouse has a truly beautiful atmosphere – the architecture and decor are stunning, and the staff is genuinely warm and welcoming. Traditional afternoon tea features over 80 premium teas. Established in 1990 My introduction to Boulder was this splendid tea house, with a beautiful indoor space and extensive outdoor seating, near a mountain stream. It is the perfect mid-day indulgence to break up a busy schedule, catch up with friends or bond with loved ones. Established in 1990 Get menu, photos and location information for The Boulder Dushanbe Teahouse in Boulder, CO. The Boulder Dushanbe Teahouse is nestled against the Rocky Mountain Foothills in Boulder Colorado. We ask for your support in this new sustainable practice. I had… Boulder Dushanbe Tea House – a restaurant in the 2023 MICHELIN Guide USA. Order online and track your order live. The true beginnings of the teahouse were in the 1980s when Boulder and Dushanbe, the capital city of Tajikistan, became sister cities. Enjoy the delectable full-menu cuisine or stop in for a quick sip of tea or coffee from around the world. American Breakfast 13 GFO scrambled eggs with cheese, bacon, lapsang souchong tea sausage, potato, house-made pop tart Lapsang Souchong Benedict* 14 poached egg, lapsang souchong tea sausage, English muffin, green tea hollandaise, potato Greek Scramble 11. I find just being in the building to be so relaxing. Can I come to the Teahouse just to enjoy a cup of tea? Specialties: The Boulder Dushanbe Teahouse is nestled against the Rocky Mountain Foothills in Boulder Colorado. Nestled in the heart of Boulder’s vibrant downtown, this picturesque teahouse offers a one-of-a-kind experience that perfectly blends culture, history, and, of course, delicious tea. Specialty Coffee Vietnamese Coffee 5. Whether you’re a local or just passing through Boulder, CO, here’s everything you need to know. Stepping into the Boulder Dushanbe Tea House feels like entering a vibrant tapestry woven with threads of Central Asian artistry and global flavors. Or book now at one of our other 7412 great restaurants in Boulder. Jasmine Pearls (~$5): top quality tea leaves scented with fresh jasmine blossoms and rolled into tiny… Specialties: The Boulder Dushanbe Teahouse is nestled against the Rocky Mountain Foothills in Boulder Colorado. It's less crowded and the food is delicious… Specialties: The Boulder Dushanbe Teahouse is nestled against the Rocky Mountain Foothills in Boulder Colorado. Jasmine Pearls (~$5): top quality tea leaves scented with fresh jasmine blossoms and rolled into tiny… Sep 6, 2024 · The Boulder Dushanbe Teahouse is a beautifully ornate venue, featuring a diverse global tea selection and international cuisine in a unique cultural setting. This teahouse is a gift from Dushanbe, Tajikistan. ” Traditionally, Mondays are the days that bazaars are held in Tajikistan. If the bucolic setting doesn't lower your blood pressure, the stunning interior that transports you to a faraway culture will. Mar 31, 2024 · People dine for lunch or tea at the Boulder Dushanbe Teahouse this month in Boulder. Established in 1990 The Dushanbe Tea House: A Unique Boulder Gem You Can’t Miss If you’re looking for something truly special in Boulder, Colorado, the Dushanbe Tea House is an absolute must-see. The rose gardens in front of the Teahouse include over 50 varieties of heirloom roses, which were first grown in Central Asia. This architectural masterpiece, a gift from Boulder’s sister city Dushanbe, the capital of Tajikistan, is a symbol of friendship and cultural exchange. With nearly 100 types of tea, delicious international cuisine, and colorful artwork adorning the walls, it is an inviting and peaceful place to enjoy a cup of tea or some bite to eat. ONLINE RESERVATIONS FOR DINNER We do not accept reservations for Brunch or Lunch. Established in 1990 Get delivery or takeout from Boulder Dushanbe Teahouse at 1770 13th Street in Boulder. Completely built by hand without the use of any power tools, the Teahouse was HOT Our Famous Housemade Chai $3. As the name suggests, tea is the raison d'être here, and The actual menu of the The Boulder Dushanbe Teahouse cafe. Established in 1990 Traditional Persian Teahouse featuring an eclectic, international menu with organic produce from the owners' farm and teas from all over the world. As the name suggests, tea is the raison d'être here, and Boulder Dushanbe Teahouse 1770 13th Street, Boulder, CO, 80302, United States 303-442-4993 info@boulderteahouse. Link in bio. Up to date Boulder Dushanbe Teahouse menu and prices, including breakfast, dinner, kid's meal and more. The ornate building was constructed entirely by hand by over 40 master artisans from Tajikistan, and is the only one of its kind in the United States. Apr 19, 2024 · TL;DR Dushanbe Tea House in Boulder, Colorado, is an acclaimed destination due to its intricate architecture, artisan craftsmanship, and rich multicultural traditions. Persian Chickpea Kufteh at Boulder Dushanbe Teahouse "Went here due to the great reviews and hype. 5 GF salsa verde, tomatoes, nopales, chorizo, caramelized pearl onions, queso Oaxaca, hand pressed black bean tortillas Swedish Svamptoast 12 GFO wild mushroom, shallots, garlic, white wine, goat cheese, truffle oil, grilled artisanal bread Persian Dolma Bademjan 10. It's time to degustate delicious white tea, chai latte or vietnamese coffee. "This is a gift to the people of Boulder to make their souls happy" The Teahouse, which officially opened May 15, 1998, is a gift from Boulder's sister city, Dushanbe, Tajikistan Sip tea and savor the atmosphere at the beautiful Boulder Dushanbe Teahouse, built in connection with Boulder's sister city Dushanbe, located in Tajikistan. As the name suggests, tea Tajikistan Plov at Boulder Dushanbe Teahouse "We hadn't been here in years. For general information on food allergens, please visit the Food Allergy Research and Education website. Established in 1990 Mar 31 Our new Children's Tea Canisters are now available at the Boulder Dushanbe Teahouse and from our website. Below we provide specific dish information on the 8 Major Food Allergens: Milk, Eggs, Fish, Shellfish, Tree Nuts, Peanuts, Wheat, and Soybean. As the name suggests, tea is the raison d'être here, and . My interest was the English style afternoon tea. The teahouse was a gift to the city of Boulder by the mayor of Dushanbe, Tajikistan, after a visit in 1987 and establishment of a sister city program. The Fountain of Seven Beauties is a center teahouse pool. The MICHELIN inspectors’ point of view, information on prices, types of cuisine and opening hours on the MICHELIN Guide's official website Specialties: The Boulder Dushanbe Teahouse is nestled against the Rocky Mountain Foothills in Boulder Colorado. As the name suggests, tea is the raison d'être here, and This hand-built gift from Dushanbe, Boulder's sister city in Tajikistan, offers a respite from quotidian life. We are open for breakfast, lunch and dinner daily. Established in 1990 Juice at Boulder Dushanbe Teahouse "Ordered:Rainforest Iced Tea (~$4): lemonade, pineapple juice, ginseng mango mate energizer. Unfortunately, after the teahouse was Specialties: The Boulder Dushanbe Teahouse is nestled against the Rocky Mountain Foothills in Boulder Colorado. We ordered four dishes--two appetizers and two entrees--and a couple… Specialties: The Boulder Dushanbe Teahouse is nestled against the Rocky Mountain Foothills in Boulder Colorado. Food delivery is a big plus of this place. Merchant Gift Cards Available Buy Boulder Dushanbe Teahouse Gift Cards Sep 17, 2023 · We visited the beautifully crafted Boulder Dushanbe Teahouse in Boulder, Colorado for afternoon tea featuring savories, lemon scones and tasty desserts. Established in 1990 Children’s Menu all meals $8 Lunch & Dinner Tori No Karaage (GF) Chicken nuggets served with Japanese dipping sauce Choice of rice or fries (add $1) Bakmie Goreng (GF) Balinese stir fried rice noodles, vegetables, sweet tamari sauce Add chicken or tofu $3 Grilled Cheese or Grilled Ham & Cheese served with fries Chicken or Cheese Quesadilla Sara is the tea specialist and blender at the Boulder Dushanbe Teahouse and has created a number of the Teahouse’s exclusive tea blends. The Boulder Dushanbe Teahouse was created as a gift to the city of Boulder, Colorado, from its sister city Dushanbe, the capital of the Tajik Soviet Socialist Republic, then part of the Soviet Union and now Tajikistan, in 1987. The sky cleared Feb 17, 2025 · The Tajikistan capital city gifted a one-of-a-kind, handmade tea house to the Colorado mountain town, and for the last 26 years, Boulder Dushanbe Teahouse has impressed visitors and locals alike. The MICHELIN inspectors’ point of view, information on prices, types of cuisine and opening hours on the MICHELIN Guide's official website Jan 25, 2025 · The Dushanbe Tea House is a part of the Boulder Dushanbe sister city project, and is named after Tajikistan’s capital city, and is a word meaning “Monday. Prices and visitors' opinions on dishes. Dive into the menu of The Boulder Dushanbe Teahouse in Boulder, CO right here on Sirved. In addition to her clinical practice for humans, Sara also consults for both equine and canine clients, and creates customized formulas to increase health, performance, and vitality. Its ornate carved plaster panels, colorful ceramic tile mosaics and fragrant rose garden are a breath of fresh air amid downtown Boulder’s prevailing brick motif. Established in 1990 Jan 8, 2025 · The Dushanbe Tea House’s architectural splendor is a testament to the extraordinary craftsmanship of Tajik artisans. Many are exclusive imports and blends. The restaurant The Boulder Dushanbe Teahouse has received 1913 user ratings with a score of 79. Completely built by hand without the use of any power tools, the Teahouse was Specialties: The Boulder Dushanbe Teahouse is nestled against the Rocky Mountain Foothills in Boulder Colorado. Aug 20, 2014 · Boulder Dushanbe Teahouse Boulder Dushanbe Teahouse is an exquisite gift from Boulder's sister-city of Dushanbe is the country’s only authentic Tajik teahouse. I loved the overall atmosphere and vibe of the place. Indian Samosas at Boulder Dushanbe Teahouse "Wow, this place is amazing. Established in 1990 Boulder Dushanbe Teahouse Menu and Prices. As the name suggests, tea is the raison d'être here, and Oct 30, 2020 · The Boulder Dushanbe Teahouse Lunch Experience Guests enjoy exquisite ambiance and fascinating history with hand carved elements that reflect 40 great artisans’ historic motifs above and all around this handsome restaurant and tea house. Kookoo Sabzi at Boulder Dushanbe Teahouse "I've been wanting to go here for so long and I'm so excited that we finally got the chance! We stopped in on a Saturday morning around noon for brunch and although it was busy, we were able to get… The Teahouse cannot guarantee the complete absence of any allergen in our restaurant. 75 GFO eggs with spinach, tomato, olive, feta, potato & a biscuit Kookoo Sabzi 11. Established in 1990 The Boulder Dushanbe Teahouse is nestled against the Rocky Mountain Foothills in Boulder Colorado. Take a look at our Teahouse Logo products for some unique gift ideas!Tajikistan created the decorative elements our Teahouse, including its hand-carved and Details The beautiful and unique Dushanbe is an authentic Persian teahouse and the only one in the Western Hemisphere. View the online menu of The Boulder Dushanbe Teahouse and other restaurants in Boulder, Colorado. Established in 1990 Boulder Dushanbe Tea House – a restaurant in the 2023 MICHELIN Guide USA. From 1987 -1990, more than 40 artisans in several cities of Tajikistan created the decorative elements our Teahouse, including its hand-carved and hand-painted ceiling May 30, 2024 · The Dushanbe Teahouse stands as a vibrant testament to the cultural and culinary diversity that enriches the city. In addition, they offer a full bar and a lovely creek-side patio. 25 traditional indian spiced tea made fresh daily, served iced or hot substitute almond or soy milk $1 Lady London Fog $5 lady grey’s garden tea, steamed milk, vanilla substitute almond or soy milk $1 Golden Milk $5 almond & coconut milk, turmeric, ginger, cinnamon, clove, honey Matcha Latte $4 house matcha simple, whole milk substitute almond or soy milk $1 The Boulder Dushanbe Teahouse is nestled against the Rocky Mountain Foothills in Boulder Colorado. Established in 1990 At The Teahouse, there is a 4 % Kitchen & Farmer Living Wage Surcharge added to each Guest check to address the growing wage disparity among restaurant team members. The Specialties: The Boulder Dushanbe Teahouse is nestled against the Rocky Mountain Foothills in Boulder Colorado. Completely built by hand without the use of any power tools, the Teahouse was Latest reviews, photos and ratings for The Boulder Dushanbe Teahouse at 1770 13th St in Boulder - view the menu, hours, phone number, address and map. Olga Feheley and The Boulder Dushanbe Teahouse is nestled against the Rocky Mountain Foothills in Boulder Colorado. ostefajvvuyjrrjlqkwwgrlqlwkqcrqqehikytrmwpqwttzzmd
